|
![]() |
ORDER
SPECIFICATIONS
Antigen Symbol | TMEM93 |
Antigen Name | Transmembrane Protein 93 |
Reactivity | Human |
Conjugation | Unconjugated |
Clonality | Polyclonal |
Antibody Type | Primary |
Host | Rabbit |
Isotype | IgG |
Western Blot | Yes |
Antigen Synonyms | transmembrane protein 93, MGC2963 |
Gene ID | 83460 |
Immunogen | Synthetic peptides corresponding to TMEM93(transmembrane protein 93) The peptide sequence was selected from the N terminal of TMEM93. Peptide sequence AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG. |
Purification | Immunogen affinity purified |
Storage Buffer | PBS and 2% Sucrose |
Storage Temperature | Store at -20C. Avoid freeze-thaw cycles. |