|
![]() |
ORDER
SPECIFICATIONS
Antigen Symbol | TMEM147 |
Antigen Name | Transmembrane Protein 147 |
Reactivity | Rat |
Conjugation | Unconjugated |
Clonality | Polyclonal |
Antibody Type | Primary |
Host | Rabbit |
Isotype | IgG |
Western Blot | Yes |
Antigen Synonyms | seven transmembrane domain protein, MGC1936, NIFIE14, transmembrane protein 147, Protein NIFIE 14 |
Gene ID | 10430 |
Immunogen | The immunogen for this antibody is Tmem147. Peptide sequence VTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMS. |
Purification | Immunogen affinity purified |
Storage Buffer | PBS and 2% Sucrose |
Storage Temperature | Store at -20C. Avoid freeze-thaw cycles. |