|
![]() |
ORDER
SPECIFICATIONS
Antigen Symbol | TSPAN8/TM4SF3 |
Antigen Name | Transmembrane 4 L Six Family Member 3 |
Reactivity | Human |
Conjugation | Unconjugated |
Clonality | Polyclonal |
Antibody Type | Primary |
Host | Rabbit |
Isotype | IgG |
Western Blot | Yes |
Antigen Synonyms | tetraspanin 8, Transmembrane 4 superfamily member 3tetraspanin-8, Tumor-associated antigen CO-029, Tspan-8, CO-029, TM4SF3tspan-8 |
Gene ID | 7103 |
Immunogen | Synthetic peptides corresponding to TSPAN8(tetraspanin 8) The peptide sequence was selected from the middle region of TSPAN8. Peptide sequence VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG. |
Purification | Immunogen affinity purified |
Storage Buffer | PBS and 2% Sucrose |
Storage Temperature | Store at -20C. Avoid freeze-thaw cycles. |