|
![]() |
ORDER
SPECIFICATIONS
Antigen Symbol | TIM-3 |
Antigen Name | Hepatitis A virus cellular receptor 2 |
Reactivity | Human |
Conjugation | Unconjugated |
Clonality | Polyclonal |
Antibody Type | Primary |
Host | Rabbit |
Isotype | IgG |
Western Blot | Yes |
Antigen Synonyms | TIMD3KIM-3, TIM 3, hepatitis A virus cellular receptor 2, kidney injury molecule-3, TIMD-3, CD366, T cell immunoglobulin mucin 3, HAVcr-2, FLJ14428, TIM3 T-cell membrane protein 3, Tim-3, T-cell immunoglobulin and mucin domain-containing protein 3, T cell immunoglobulin mucin-3 |
Gene ID | 84868 |
Immunogen | Synthetic peptides corresponding to HAVCR2(hepatitis A virus cellular receptor 2) The peptide sequence was selected from the N terminal of HAVCR2. Peptide sequence MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP. |
Purification | Immunogen affinity purified |
Storage Buffer | PBS and 2% Sucrose |
Storage Temperature | Store at -20C. Avoid freeze-thaw cycles. |