Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-THYN1 Rabbit Polyclonal Antibody

Supplier: Novus Biologicals
The THYN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to THYN1. This antibody reacts with human. The THYN1 Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: THYN1
Clonality: Polyclonal
Conjugation: Unconjugated
Host: Rabbit
Isotype: IgG
Reactivity: Human

Log in to see your contract pricing and availability.
  Remember me on this device

Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100 μl NBP1-55405 102185-754 Each Retrieving Restricted

Temperature sensitive This Item is temperature sensitive and has specific temperature and storage requirements for shipping/delivery. Requires a maximum 2 day delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

Antigen Symbol THYN1
Antigen Name Thymocyte Nuclear Protein 1
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody Type Primary
Host Rabbit
Isotype IgG
Western Blot Yes
Antigen Synonyms MDS012, HSPC144, THY28MY105, MGC12187, thymocyte nuclear protein 1, Thymocyte protein Thy28, THY28KD
Gene ID 29087
Immunogen Synthetic peptides corresponding to THYN1(thymocyte nuclear protein 1) The peptide sequence was selected from the middle region of THYN1. Peptide sequence NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK.
Purification Immunogen affinity purified
Storage Buffer PBS and 2% Sucrose
Storage Temperature Store at -20C. Avoid freeze-thaw cycles.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty