|
![]() |
ORDER
SPECIFICATIONS
Antigen Symbol | THEG |
Antigen Name | Theg spermatid Protein |
Reactivity | Human |
Conjugation | Unconjugated |
Clonality | Polyclonal |
Antibody Type | Primary |
Host | Rabbit |
Isotype | IgG |
Western Blot | Yes |
Antigen Synonyms | Theg homolog, testis-specific, Theg homolog (mouse), MGC26138, CT56Cancer/testis antigen 56 |
Gene ID | 51298 |
Immunogen | Synthetic peptide directed towards the middle region of human THEG. Peptide sequence: LKDRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTT |
Purification | Immunogen affinity purified |
Storage Buffer | PBS and 2% Sucrose |
Storage Temperature | Store at -20C. Avoid freeze-thaw cycles. |