Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-SLCO2B1 Rabbit Polyclonal Antibody

Supplier: Novus Biologicals
NBP1-59811
The SLCO2B1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLCO2B1. This antibody reacts with human. The SLCO2B1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence.

Type: Primary
Antigen: SLCO2B1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




Log in to see your contract pricing and availability.
  Remember me on this device
 

ORDER

Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100 μl NBP1-59811 102193-306 Each Retrieving Restricted

Temperature sensitive This Item is temperature sensitive and has specific temperature and storage requirements for shipping/delivery. Requires a maximum 2 day delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen Symbol SLCO2B1
Antigen Name Solute Carrier Organic Anion Transporter Family Member 2B1
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody Type Primary
Host Rabbit
Isotype IgG
Western Blot Yes
ImmunoChemistry Yes
ImmunoFluorescence Yes
Antigen Synonyms solute carrier organic anion transporter family, member 9, OATPBDKFZp686E0517, OATP2B1OATP-RP2, OATP-BKIAA0880, Organic anion transporter polypeptide-related protein 2, Organic anion transporter B, OATPRP2, SLC21A9solute carrier organic anion transporter family member 2B1, Solute carrier family 21 member 9, member 2B1, solute carrier family 21 (organic anion transporter)
Gene ID 11309
Immunogen Synthetic peptides corresponding to SLCO2B1(solute carrier organic anion transporter family, member 2B1) The peptide sequence was selected from the N terminal of SLCO2B1. Peptide sequence DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ.
Purification Immunogen affinity purified
Storage Buffer PBS and 2% Sucrose
Storage Temperature Store at -20C. Avoid freeze-thaw cycles.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty