Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-ZnT-8/SLC30A8 Rabbit Polyclonal Antibody

Supplier: Novus Biologicals
NBP1-59424
The ZnT-8 / SLC30A8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZnT-8 / SLC30A8. This antibody reacts with human. The ZnT-8 / SLC30A8 Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: ZnT-8/SLC30A8
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




Log in to see your contract pricing and availability.
  Remember me on this device
 

ORDER

Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100 μl NBP1-59424 102192-540 Each Retrieving Restricted

Temperature sensitive This Item is temperature sensitive and has specific temperature and storage requirements for shipping/delivery. Requires a maximum 2 day delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen Symbol SLC30A8
Antigen Name ZnT-8/SLC30A8
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody Type Primary
Host Rabbit
Isotype IgG
Western Blot Yes
Antigen Synonyms ZNT8ZnT-8, zinc transporter 8, solute carrier family 30 (zinc transporter), Solute carrier family 30 member 8, zinc transporter ZnT-8, member 8
Gene ID 169026
Immunogen Synthetic peptides corresponding to SLC30A8(solute carrier family 30 (zinc transporter), member 8) The peptide sequence was selected from the middle region of SLC30A8. Peptide sequence LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG.
Purification Immunogen affinity purified
Storage Buffer PBS and 2% Sucrose
Storage Temperature Store at -20C. Avoid freeze-thaw cycles.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty