Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-SLC1A5 Rabbit Polyclonal Antibody

Supplier: Novus Biologicals
The SLC1A5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC1A5. This antibody reacts with human. The SLC1A5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Type: Primary
Antigen: SLC1A5
Clonality: Polyclonal
Conjugation: Unconjugated
Host: Rabbit
Isotype: IgG
Reactivity: Human



Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100μl NBP1-59732 102193-152 Each Retrieving Restricted

Temperature sensitive This Item is temperature-controlled and may have specific temperature and storage requirements for shipping/delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page


Antigen Symbol SLC1A5
Antigen Name Solute Carrier Family 1 Member A5
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody Type Primary
Host Rabbit
Isotype IgG
Western Blot Yes
ImmunoChemistry Yes
Antigen Synonyms neutral amino acid transporter B(0), ASCT2M7VS1, solute carrier family 1 (neutral amino acid transporter), RDRCFLJ31068, AAAT, Solute carrier family 1 member 5, RD114 virus receptor, R16, RDR, Sodium-dependent neutral amino acid transporter type 2, member 5, neutral amino acid transporter B, ATB(0), M7V1ATBO, RD114/simian type D retrovirus receptor, Baboon M7 virus receptor
Gene ID 6510
Immunogen Synthetic peptides corresponding to SLC1A5(solute carrier family 1 (neutral amino acid transporter), member 5) The peptide sequence was selected from the middle region of SLC1A5 (NP_005619). Peptide sequence FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMF
Purification Protein A purified
Storage Buffer PBS and 2% Sucrose
Storage Temperature Store at -20C. Avoid freeze-thaw cycles.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping