Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-SKIV2L Rabbit Polyclonal Antibody

Supplier: Novus Biologicals
NBP1-57119
The SKIV2L Antibody from Novus Biologicals is a rabbit polyclonal antibody to SKIV2L. This antibody reacts with human. The SKIV2L Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: SKIV2L
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




 

ORDER

Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100 μl NBP1-57119 102189-140 Each Retrieving Restricted

Temperature sensitive This Item is temperature-controlled and may have specific temperature and storage requirements for shipping/delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen Symbol SKIV2L
Antigen Name Superkiller Viralicidic Activity 2-like
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody Type Primary
Host Rabbit
Isotype IgG
Western Blot Yes
Antigen Synonyms W, SKI2Wsuperkiller viralicidic activity 2 (S. cerevisiae homolog)-like, superkiller viralicidic activity 2-like (S. cerevisiae), 170A, SKI2, SKIV2, DDX13helicase SKI2W, EC 3.6.1, HLPEC 3.6.4.-, Helicase-like protein
Gene ID 6499
Immunogen Synthetic peptides corresponding to SKIV2L(superkiller viralicidic activity 2-like (S. cerevisiae)) The peptide sequence was selected from the middle region of SKIV2L. Peptide sequence SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP.
Purification Immunogen affinity purified
Storage Buffer PBS & 2% Sucrose.
Storage Temperature Store at -20C. Avoid freeze-thaw cycles.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping