Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-MRPL28 Rabbit Polyclonal Antibody

Supplier: Novus Biologicals
NBP1-54657
Rabbit Polyclonal MRPL28 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human, Mouse, Rat.

Type: Primary
Antigen: MRPL28
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human




 

ORDER

Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100 μl NBP1-54657 102184-282 Each Retrieving Restricted

Temperature sensitive This Item is temperature-controlled and may have specific temperature and storage requirements for shipping/delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen Symbol MRPL28
Antigen Name Mitochondrial Ribosomal Protein L28
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody Type Primary
Host Rabbit
Isotype IgG
Western Blot Yes
Antigen Synonyms p15, L28mt, mitochondrial ribosomal protein L28, MGC8499, MAAT139S ribosomal protein L28, Melanoma-associated antigen recognized by T lymphocytes, Melanoma antigen p15, MRP-L28, melanoma-associated antigen recognised by cytotoxic T lymphocytes, mitochondrial
Gene ID 10573
Immunogen Synthetic peptides corresponding to MRPL28(mitochondrial ribosomal protein L28) The peptide sequence was selected from the middle region of MRPL28. Peptide sequence EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK.
Purification Immunogen affinity purified
Storage Buffer PBS and 2% Sucrose
Storage Temperature Store at -20C. Avoid freeze-thaw cycles.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping