|
![]() |
ORDER
SPECIFICATIONS
Antigen Symbol | MMADHC |
Antigen Name | Methylmalonic aciduria And homocystinuria type C |
Reactivity | Human |
Conjugation | Unconjugated |
Clonality | Polyclonal |
Antibody Type | Primary |
Host | Rabbit |
Isotype | IgG |
Western Blot | Yes |
Antigen Synonyms | cblD, mitochondrial, with homocystinuria, protein C2orf25, chromosome 2 open reading frame 25, methylmalonic aciduria (cobalamin deficiency) cblD type |
Gene ID | 27249 |
Immunogen | Synthetic peptides corresponding to MMADHC. The peptide sequence was selected from the middle region of MMADHC (NP_056517). Peptide sequence RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI. |
Purification | Immunogen affinity purified |
Storage Buffer | PBS and 2% Sucrose |
Storage Temperature | Store at -20C. Avoid freeze-thaw cycles. |