Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-ST3GAL4 Rabbit Polyclonal Antibody

Supplier: Novus Biologicals
NBP2-13390
The ST3GAL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST3GAL4. This antibody reacts with human. The ST3GAL4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.

Type: Primary
Antigen: ST3GAL4
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




 

ORDER

Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100 μl NBP2-13390 103285-764 Each (100µl) Retrieving Restricted

Temperature sensitive This Item is temperature sensitive and has specific temperature and storage requirements for shipping/delivery. Shipping duration cannot exceed 2 days.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen Symbol ST3GAL4
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody Type Primary
Host Rabbit
Isotype IgG
ImmunoChemistry Yes
Antigen Synonyms STZSIAT4, CGS23FLJ46764, Gal-NAc6S, ST3GalIV, SAT-3, NANTA3alpha-3-N-acetylneuraminyltransferase, SAT3, sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase), ST3 beta-galactoside alpha-2,3-sialyltransferase 4, ST3Gal IV, SIAT4-C, SIAT4CCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, ST-4, ST3GalA.2, gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase, Alpha 2,3-ST 4, sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase), Sialyltransferase 4C, Beta-galactoside alpha-2,3-sialyltransferase 4, Alpha 2,3-sialyltransferase IV, EC 2.4.99.-, EC 2.4.99, FLJ11867, EC 2.4.99.9
Gene ID 6484
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDY FWVKTPSAYE
Purification Immunogen affinity purified
Storage Buffer PBS (pH 7.2) and 40% Glycerol
Storage Temperature Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty