Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-PNUTS/PPP1R10 Mouse Monoclonal Antibody [clone: 1D6]

Supplier: Novus Biologicals
H00005514-M02
The PNUTS / PPP1R10 Antibody (1D6) from Novus Biologicals is a mouse monoclonal antibody to PNUTS / PPP1R10. This antibody reacts with human. The PNUTS / PPP1R10 Antibody (1D6) has been validated for the following applications: Western Blot, ELISA.

Type: Primary
Antigen: PNUTS/PPP1R10
Clonality: Monoclonal
Clone: 1D6
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

ORDER

Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100 μg H00005514-M02 103307-944 Each (100µG) Retrieving Restricted

Temperature sensitive This Item is temperature-controlled and may have specific temperature and storage requirements for shipping/delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen Symbol PNUTS/PPP1R10
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody Type Primary
Clone 1D6
Host Mouse
Isotype IgG2a Kappa
Western Blot Yes
ELISA Yes
Antigen Synonyms FB19PP1-binding protein of 114 kDa, regulatory (inhibitor) subunit 10, Protein FB19, regulatory subunit 10, phosphatase nuclear targeting subunit, MHC class I region proline-rich protein CAT53, PNUTSPP1R10, protein phosphatase 1 regulatory subunit 10, Phosphatase 1 nuclear targeting subunit, CAT53, p99, serine/threonine-protein phosphatase 1 regulatory subunit 10, protein phosphatase 1
Gene ID 5514
Immunogen PPP1R10 (NP_002705.2, 1 a.a. - 83 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK
Purification IgG purified
Storage Buffer PBS (pH 7.4)
Storage Temperature Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping