Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-PLA2G1B Mouse Monoclonal Antibody [clone: 1B3]

Supplier: Novus Biologicals
The PLA2G1B Antibody (1B3) from Novus Biologicals is a mouse monoclonal antibody to PLA2G1B. This antibody reacts with human. The PLA2G1B Antibody (1B3) has been validated for the following applications: Western Blot, ELISA.

Type: Primary
Antigen: PLA2G1B
Clonality: Monoclonal
Clone: 1B3
Conjugation: Unconjugated
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human

Log in to see your contract pricing and availability.
  Remember me on this device


Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100 μg H00005319-M01 103307-566 Each (100µG) Retrieving Restricted

Temperature sensitive This Item is temperature sensitive and has specific temperature and storage requirements for shipping/delivery. Requires a maximum 2 day delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page


Antigen Symbol PLA2G1B
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody Type Primary
Clone 1B3
Host Mouse
Isotype IgG2a Kappa
Western Blot Yes
Antigen Synonyms PPLA2MGC119835, Phosphatidylcholine 2-acylhydrolase 1B, PLA2AMGC119834, Group IB phospholipase A2, group IB (pancreas), PLA2EC, phospholipase A2
Gene ID 5319
Immunogen PLA2G1B (AAH05386, 17 a.a. - 70 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV
Purification IgG purified
Storage Buffer PBS (pH 7.4)
Storage Temperature Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty