|
![]() |
ORDER
SPECIFICATIONS
Antigen Symbol | PERP |
Reactivity | Human |
Conjugation | Unconjugated |
Clonality | Polyclonal |
Antibody Type | Primary |
Host | Rabbit |
Isotype | IgG |
ImmunoChemistry | Yes |
Antigen Synonyms | KRTCAP11110017A08Rik, PERP, Transmembrane protein THW, THWkeratinocytes associated protein 1, dJ496H19.1, KCP1KCP-1, PIGPC1RP3-496H19.1, Keratinocyte-associated protein 1, P53-induced protein PIGPC1, p53 apoptosis effector related to PMP22, TP53 apoptosis effector, p53 apoptosis effector related to PMP-22 |
Gene ID | 64065 |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW |
Purification | Immunogen affinity purified |
Storage Buffer | PBS (pH 7.2) and 40% Glycerol |
Storage Temperature | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |