|
![]() |
ORDER
SPECIFICATIONS
Antigen Name | Ankyrin repeat domain 39 |
Reactivity | Human |
Conjugation | Unconjugated |
Clonality | Polyclonal |
Antibody Type | Primary |
Host | Rabbit |
Isotype | IgG |
Western Blot | Yes |
ImmunoChemistry | Yes |
ImmunoFluorescence | Yes |
Antigen Synonyms | ankyrin repeat domain-containing protein 39, MGC41816, ankyrin repeat domain 39 |
Gene ID | 51239 |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTE |
Purification | Immunogen affinity purified |
Storage Buffer | PBS (pH 7.2) and 40% Glycerol |
Storage Temperature | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |