Human Cys-beta-Amyloid (1-42)

Supplier: AnaSpec
AS-23538 AS-23537
102999-618EA 1734.85 USD
102999-618 102999-616
Human Cys-beta-Amyloid (1-42)
Proteins and Peptides
This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Order Now

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR