Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-FXN Mouse Monoclonal Antibody [clone: 3C3]

Supplier: Abnova
H00002395-M04
Mouse monoclonal antibody raised against a partial recombinant FXN.

Recommended Dilutons: Western Blot (1-5 ug/mL)

Type: Primary
Antigen: FXN
Clonality: Monoclonal
Clone: 3C3
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human




 

ORDER

Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
100 µg H00002395-M04 10586-866 Each (100µG) Retrieving Restricted

Temperature sensitive This Item is temperature-controlled and may have specific temperature and storage requirements for shipping/delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen Symbol FXN
Antigen Name Frataxin
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody Type Primary
Clone 3C3
Host Mouse
Isotype IgG1 kappa
Western Blot Yes
ELISA Yes
Antigen Synonyms FARR, mitochondrial, Frataxin, Frataxin intermediate form, Friedreich ataxia protein, CyaY, frataxin, FRDA, FA, X25
Cross Adsorption No
Immunogen FXN (AAH48097.1, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
Form Liquid
Storage Buffer In 1x PBS, pH 7.4
Storage Temperature Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping