Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH, Bachem

H-7346.0500 H-7346.1000
Nesfatin-1 (30-59), YDEYLKQVIDVLETDKHFREKLQKADIEEI, is the active core fragment of full length 82-mer nesfatin-1. The fragment induces dose-dependent reduction of food intake.

  • Sequence: H-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-OH
  • CAS-No.:
  • Mol.weight: 3709.17
  • SumFormula: C₁₆₇H₂₆₃N₄₁O₅₄
  • Bulk item no.: H-7346
  • Synonym(s):
  • EINECS no.: -
  • MDL no.:

Nesfatin-1 is a satiety molecule that is associated with melanocortin signaling in the hypothalamus.



Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
0.5 mg H-7346.0500 H-7346.0500BA Each (500µG) Retrieving

Temperature sensitive This Item is temperature sensitive and has specific temperature and storage requirements for shipping/delivery. Shipping duration cannot exceed 2 days.

1 mg H-7346.1000 H-7346.1000BA Each (1mg) Retrieving

Temperature sensitive This Item is temperature sensitive and has specific temperature and storage requirements for shipping/delivery. Shipping duration cannot exceed 2 days.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page


Protein/Peptide Name Nesfatin-1 (30-59)
Species Human
Molecular Weight 3709.17
Molecular Formula C₁₆₇H₂₆₃N₄₁O₅₄
Storage Conditions -20 ± 5 °C
Salt Trifluoroacetate
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty