Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-TCIRG1 Mouse Monoclonal Antibody [clone: 7H20]

Supplier: Abnova
H00010312-M02A
Mouse monoclonal antibody raised against a partial recombinant TCIRG1.

Type: Primary
Antigen: TCIRG1
Clonality: Monoclonal
Clone: 7H20
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human




 

ORDER

Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
200 µL H00010312-M02A 10625-322 Each (200µl) Retrieving Restricted

Temperature sensitive This Item is temperature-controlled and may have specific temperature and storage requirements for shipping/delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen Symbol TCIRG1
Antigen Name T-cell, immune Regulator 1, ATPase, H+ transporting, lysosomal V0 Subunit A3
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody Type Primary
Clone 7H20
Host Mouse
Isotype IgG1 kappa
Western Blot Yes
ELISA Yes
Antigen Synonyms Atp6i, ATP6N1C, OC116, TIRC7, Osteoclastic proton pump 116 kDa subunit, ATP6V0A3, V-type proton ATPase 116 kDa subunit a isoform 3, V-ATPase 116 kDa isoform a3, OC-116kDa, Stv1, TCIRG1, a3, OPTB1, Vph1
Amino Acid Number 121 to 220
Gene ID 10312
Format Liquid
Cross Adsorption No
Immunogen TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL
Form Ascites fluid
Storage Temperature Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping