Keep my session open?
Ending In 
Your shopping session has expired.
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

CRF (human, rat)

H-2435.0001 H-2435.0005
Sequence: H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH₂
CAS-No.: 86784-80-7
Mol.weight: 4757.52
SumFormula: C₂₀₈H₃₄₄N₆₀O₆₃S₂
Bulk item no.: H-2435
Synonym(s): Corticoliberin#Corticorelin#CRF-41#CRH#Corticotropin Releasing Factor, human, rat
EINECS no.: -
MDL no.: MFCD00213806

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

Log in to see your contract pricing and availability.
  Remember me on this device


Expand All / Collapse All
Size Supplier No. VWR Catalog Number Unit Price Quantity
1 mg H-2435.0001 H-2435.0001BA Each (1mg) Retrieving Restricted

Temperature sensitive This Item is temperature sensitive and has specific temperature and storage requirements for shipping/delivery. Requires a maximum 2 day delivery.

5 mg H-2435.0005 H-2435.0005BA Each (5mg) Retrieving Restricted

Temperature sensitive This Item is temperature sensitive and has specific temperature and storage requirements for shipping/delivery. Requires a maximum 2 day delivery.

restricted In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page


Protein/Peptide Name CRF
Synonyms Corticoliberin, Corticorelin, CRF-41, CRH
Species Human, Rat
CAS No. 86784-80-7
Molecular Weight 4757.52
Molecular Formula C₂₀₈H₃₄₄N₆₀O₆₃S₂
Storage Temperature -20 ± 5 °C
Salt Acetate
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty